LRAT Rabbit Polyclonal Antibody (FITC)

SKU: orb2098218

Description

Images & Validation

−

Predicted Reactivity	Human, Porcine

Related Conjugates & Formulations

−

Unconjugated

Biotin

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human LRAT
Protein Sequence	Synthetic peptide located within the following region: MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDV
Molecular Weight	25 kDa
Purification	Affinity purified
Conjugation	FITC

Storage & Handling

−

Storage	For short term use, store at 2-8℃ up to 1 week. For long term storage, store at -20℃ in small aliquots to prevent freeze-thaw cycles
Form/Appearance	Liquid
Buffer/Preservatives	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

LCA14

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

O95237

RefSeq (Protein):NP_004735

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_004735

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols