You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580022 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Lpcat2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 60kDa |
Target | Lpcat2 |
UniProt ID | Q8BYI6 |
Protein Sequence | Synthetic peptide located within the following region: LGVPDLNVSGLFREIAQRDSVSYEEFKSFALKHPEYAKIFTTYLDLQTCH |
NCBI | NP_766602 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Ayt, LPC, Aytl1, Aytl1a, lpafat1, lysoPAFAT, 1-AGP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Lpcat2 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Thymus.
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |