Cart summary

You have no items in your shopping cart.

LOC100912020 Rabbit Polyclonal Antibody (Biotin)

LOC100912020 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2130206

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2130206
CategoryAntibodies
DescriptionLOC100912020 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Rat LOC100912020
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW28kDa
Protein SequenceSynthetic peptide located within the following region: TERQVKIWFQNRRMKWKKENNRDKFPASRPEAKDGDPKKEVSGLEEDGAE
NCBIXP_003749540
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.