Lmod1 Rabbit Polyclonal Antibody

SKU: orb582516

Description

Rabbit polyclonal antibody to Lmod1

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Lmod1
• Protein Sequence: Synthetic peptide located within the following region: LAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQL
• Molecular Weight: 67 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SM-L, SM-Lmod, 9530015K06Rik

WB Suggested Anti-Lmod1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Thymus.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation.

Sample Tissue: Mouse Liver, Antibody dilution: 3 ug/ml.

Quick Database Links

Gene Symbol

Lmod1

UniProt

Q8BVA4

RefSeq (Protein):NP_444336