Cart summary

You have no items in your shopping cart.

LIN7C Rabbit Polyclonal Antibody (FITC)

LIN7C Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2121516

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2121516
CategoryAntibodies
DescriptionLIN7C Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LIN7C
Protein SequenceSynthetic peptide located within the following region: MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
UniProt IDQ9NUP9
MW22kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesMALS3, VELI3, LIN-7C, MALS-3, LIN-7-C
NoteFor research use only
NCBINP_060832
  • LIN7C Rabbit Polyclonal Antibody (FITC) [orb2121513]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl