LIMD1 Rabbit Polyclonal Antibody

• Catalog Number: orb581128
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LIMD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LIMD1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: LIMD1
• UniProt ID: Q9UGP4
• Protein Sequence: Synthetic peptide located within the following region: MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFAT
• NCBI: CAC35917
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Anti-LIMD 1 antibody, anti-LIMD1 antibody.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Placenta

Human Placenta

Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-LIMD1 antibody (orb581128).

WB Suggested Anti-LIMD1 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate. LIMD1 is supported by BioGPS gene expression data to be expressed in HepG2.