LILRB2 Rabbit Polyclonal Antibody

SKU: orb585807

Description

LILRB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting LILRB2. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Human. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: LILRB2
• Protein Sequence: Synthetic peptide located within the following region: MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA
• Molecular Weight: 65 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ILT4, LIR2, CD85D, ILT-4, LIR-2, MIR10, MIR-10

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Recognizes Isoform 1 and Isoform 4 (52 kDa) in some samples.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): Human brain (BR), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-LILRB2 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.

Quick Database Links

Gene Symbol

LILRB2

UniProt

Q8N423

RefSeq (Protein):NP_005865