LILRB2 Rabbit Polyclonal Antibody

• Catalog Number: orb585807
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LILRB2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 65 kDa
• Target: LILRB2
• UniProt ID: Q8N423
• Protein Sequence: Synthetic peptide located within the following region: MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA
• NCBI: NP_005865
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ILT4, LIR2, CD85D, ILT-4, LIR-2, MIR10, MIR-10
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Recognizes Isoform 1 and Isoform 4 (52 kDa) in some samples.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): Human brain (BR), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

WB Suggested Anti-LILRB2 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.