LHX6 Rabbit Polyclonal Antibody

• Catalog Number: orb574264
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LHX6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LHX6
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: LHX6
• UniProt ID: Q9UPM6
• Protein Sequence: Synthetic peptide located within the following region: LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS
• NCBI: NP_055183
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LHX6.1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

Rabbit Anti-LHX6 Antibody, Catalog Number: orb574264, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-LHX6 Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate.