You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330221 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to LEFTY2 |
| Target | LEFTY2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Mouse, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LEFTY2 |
| Protein Sequence | Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK |
| UniProt ID | O00292 |
| MW | 40kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti EBAF antibody, anti LEFTA antibody, anti LEFT Read more... |
| Research Area | Cardiovascular Research, Disease Biomarkers, Signa Read more... |
| Note | For research use only |
| NCBI | NP_003231 |

Immunohistochemistry with Uterus tissue at an antibody concentration of 5 ug/mL using anti-LEFTY2 antibody (orb330221).

WB Suggested Anti-LEFTY2 Antibody Titration: 0.2-1 ug/mL, Positive Control: RPMI 8226 cell lysate, LEFTY2 is supported by BioGPS gene expression data to be expressed in RPMI 8226.
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review