LEFTY2 Rabbit Polyclonal Antibody

• Catalog Number: orb330221
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LEFTY2
• Target: LEFTY2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LEFTY2
• Protein Sequence: Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK
• UniProt ID: O00292
• MW: 40kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti EBAF antibody, anti LEFTA antibody, anti LEFT
• Research Area: Cardiovascular Research, Disease Biomarkers, Signa
• Note: For research use only
• NCBI: NP_003231

Immunohistochemistry with Uterus tissue at an antibody concentration of 5 ug/mL using anti-LEFTY2 antibody (orb330221).

WB Suggested Anti-LEFTY2 Antibody Titration: 0.2-1 ug/mL, Positive Control: RPMI 8226 cell lysate, LEFTY2 is supported by BioGPS gene expression data to be expressed in RPMI 8226.