LDHB antibody

• Catalog Number: orb325389
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LDHB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDHB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: LDHB
• UniProt ID: P07195
• Protein Sequence: Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
• NCBI: NP_002291
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti LDH-H antibody, anti TRG-5 antibody, anti LDH
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human 721_B tissue using LDHB antibody

Western blot analysis of human Raji tissue using LDHB antibody

Western blot analysis of human Fetal Lung, HCT116, 293T tissue using LDHB antibody

Immunohistochemical staining of human Placenta tissue using LDHB antibody

Immunohistochemical staining of human Lung tissue using LDHB antibody

Western blot analysis of human PANC1 tissue using LDHB antibody

Western blot analysis of human Fetal Lung tissue using LDHB antibody