Cart summary

You have no items in your shopping cart.

LDHB Rabbit Polyclonal Antibody

SKU: orb325389

Description

Rabbit polyclonal antibody to LDHB

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human LDHB
TargetLDHB
Protein SequenceSynthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
Molecular Weight37kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti LDH-H antibody, anti TRG-5 antibody, anti LDH-B antibody, anti LDHBD antibody

Similar Products

  • Lactate Dehydrogenase B/LDHB Rabbit Polyclonal Antibody [orb381078]

    FC,  ICC,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • LDHB Specific Rabbit Polyclonal Antibody [orb395267]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • LDHB Rabbit Polyclonal Antibody [orb628408]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • LDHB Rabbit Polyclonal Antibody [orb378155]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • LDHB rabbit pAb Antibody [orb774855]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

LDHB Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

LDHB Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

LDHB Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

LDHB Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

LDHB Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

LDHB Rabbit Polyclonal Antibody

Sample Type: Lane A: Human Fetal Lung, Lane B: Human HCT116, Lane C: Human 293T, Antibody Dilution: 0.2 ug/mL.

LDHB Rabbit Polyclonal Antibody

Positive control (+): Human lung (LU), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/mL.

LDHB Rabbit Polyclonal Antibody

Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody Dilution: 1:4000, Gene Name: LDHB.

LDHB Rabbit Polyclonal Antibody

LDHB was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb325389 with 1:200 dilution. Western blot was performed using orb325389 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: LDHB IP with orb325389 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

LDHB Rabbit Polyclonal Antibody

Rabbit Anti-LDHB Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/mL.

LDHB Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Human lung adenocarcinoma cell line A549, Primary antibody Dilution: 1:100, Secondary antibody: Goat anti-rabbit AlexaFluor 488, Secondary antibody Dilution: 1:400.

LDHB Rabbit Polyclonal Antibody

WB Suggested Anti-LDHB antibody Titration: 1 ug/mL, Sample Type: Human 721_B.

LDHB Rabbit Polyclonal Antibody

WB Suggested Anti-LDHB antibody Titration: 1 ug/mL, Sample Type: Human Raji.

LDHB Rabbit Polyclonal Antibody

WB Suggested Anti-LDHB Antibody, Titration: 1 ug/mL, Positive Control: 721_B Whole Cell, LDHB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002291

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

LDHB Rabbit Polyclonal Antibody (orb325389)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry