You have no items in your shopping cart.
LDHB Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC-P, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDHB |
| Target | LDHB |
| Protein Sequence | Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
| Molecular Weight | 37kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Lactate Dehydrogenase B/LDHB Rabbit Polyclonal Antibody [orb381078]
FC, ICC, IF, IHC, WB
Human, Monkey, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgLDHB Specific Rabbit Polyclonal Antibody [orb395267]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgLDHB Rabbit Polyclonal Antibody [orb628408]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgLDHB Rabbit Polyclonal Antibody [orb378155]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Type: Lane A: Human Fetal Lung, Lane B: Human HCT116, Lane C: Human 293T, Antibody Dilution: 0.2 ug/mL.

Positive control (+): Human lung (LU), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/mL.

Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody Dilution: 1:4000, Gene Name: LDHB.

LDHB was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb325389 with 1:200 dilution. Western blot was performed using orb325389 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: LDHB IP with orb325389 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-LDHB Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/mL.

Application: IHC, Species+tissue/cell type: Human lung adenocarcinoma cell line A549, Primary antibody Dilution: 1:100, Secondary antibody: Goat anti-rabbit AlexaFluor 488, Secondary antibody Dilution: 1:400.

WB Suggested Anti-LDHB antibody Titration: 1 ug/mL, Sample Type: Human 721_B.

WB Suggested Anti-LDHB antibody Titration: 1 ug/mL, Sample Type: Human Raji.

WB Suggested Anti-LDHB Antibody, Titration: 1 ug/mL, Positive Control: 721_B Whole Cell, LDHB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Documents Download
Request a Document
Protocol Information
LDHB Rabbit Polyclonal Antibody (orb325389)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review











