Cart summary

You have no items in your shopping cart.

LDHB Rabbit Polyclonal Antibody

SKU: orb325389

Description

Rabbit polyclonal antibody to LDHB

Research Area

Molecular Biology, Protein Biochemistry

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human LDHB
TargetLDHB
Protein SequenceSynthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
Molecular Weight37kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti LDH-H antibody, anti TRG-5 antibody, anti LDH-B antibody, anti LDHBD antibody

Similar Products

  • Lactate Dehydrogenase B/LDHB Rabbit Polyclonal Antibody [orb381078]

    FC,  ICC,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • LDHB rabbit pAb Antibody [orb774855]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • LDHB Specific Rabbit Polyclonal Antibody [orb395267]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • LDHB Rabbit Polyclonal Antibody [orb628408]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • LDHB Rabbit Polyclonal Antibody [orb378155]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

LDHB Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

LDHB Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

LDHB Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

LDHB Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

LDHB Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

LDHB Rabbit Polyclonal Antibody

Sample Type: Lane A: Human Fetal Lung, Lane B: Human HCT116, Lane C: Human 293T, Antibody Dilution: 0.2 ug/mL.

LDHB Rabbit Polyclonal Antibody

Positive control (+): Human lung (LU), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/mL.

LDHB Rabbit Polyclonal Antibody

Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody Dilution: 1:4000, Gene Name: LDHB.

LDHB Rabbit Polyclonal Antibody

LDHB was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb325389 with 1:200 dilution. Western blot was performed using orb325389 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: LDHB IP with orb325389 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

LDHB Rabbit Polyclonal Antibody

Rabbit Anti-LDHB Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/mL.

LDHB Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Human lung adenocarcinoma cell line A549, Primary antibody Dilution: 1:100, Secondary antibody: Goat anti-rabbit AlexaFluor 488, Secondary antibody Dilution: 1:400.

LDHB Rabbit Polyclonal Antibody

WB Suggested Anti-LDHB antibody Titration: 1 ug/mL, Sample Type: Human 721_B.

LDHB Rabbit Polyclonal Antibody

WB Suggested Anti-LDHB antibody Titration: 1 ug/mL, Sample Type: Human Raji.

LDHB Rabbit Polyclonal Antibody

WB Suggested Anti-LDHB Antibody, Titration: 1 ug/mL, Positive Control: 721_B Whole Cell, LDHB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002291

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

LDHB Rabbit Polyclonal Antibody (orb325389)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry