LDHB Rabbit Polyclonal Antibody

• Catalog Number: orb325389
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LDHB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDHB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: LDHB
• UniProt ID: P07195
• Protein Sequence: Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
• NCBI: NP_002291
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti LDH-H antibody, anti TRG-5 antibody, anti LDH
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Type: Lane A: Human Fetal Lung, Lane B: Human HCT116, Lane C: Human 293T, Antibody Dilution: 0.2 ug/mL.

Positive control (+): Human lung (LU), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/mL.

Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody Dilution: 1:4000, Gene Name: LDHB.

LDHB was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb325389 with 1:200 dilution. Western blot was performed using orb325389 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: LDHB IP with orb325389 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-LDHB Antibody, Paraffin Embedded Tissue: Human Placenta, Antibody Concentration: 5 ug/mL.

Application: IHC, Species+tissue/cell type: Human lung adenocarcinoma cell line A549, Primary antibody Dilution: 1:100, Secondary antibody: Goat anti-rabbit AlexaFluor 488, Secondary antibody Dilution: 1:400.

WB Suggested Anti-LDHB antibody Titration: 1 ug/mL, Sample Type: Human 721_B.

WB Suggested Anti-LDHB antibody Titration: 1 ug/mL, Sample Type: Human Raji.

WB Suggested Anti-LDHB Antibody, Titration: 1 ug/mL, Positive Control: 721_B Whole Cell, LDHB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.