LDHA Rabbit Polyclonal Antibody

• Catalog Number: orb582473
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LDHA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LDHA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37 kDa
• Target: LDHA
• UniProt ID: P00338
• Protein Sequence: Synthetic peptide located within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
• NCBI: NP_005557
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LDHM, GSD11, PIG19, HEL-S-133P
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms of ~35 kDa and 30 kDa also contain the peptide.

Anti-LDHA antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. LDHA Antibody concentration 2.5 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

LDHA antibody - N-terminal region (orb582473) validated by WB using LdhC knockout mouse sperm, LdhA transgenic kidney, IdhA transgenic testis, LdhC knockout testis at 1:1000.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-LDHA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Placenta.