LDAH Rabbit Polyclonal Antibody

SKU: orb585418

Description

Rabbit polyclonal antibody to LDAH

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: LDAH
• Protein Sequence: Synthetic peptide located within the following region: TIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFIT
• Molecular Weight: 36kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

hLDAH, C2orf43

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. C2orf43 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Rabbit Anti-C2orf43 Antibody, Catalog Number: orb585418, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Membrane, Cytoplasm in hepatocytes, moderate signal, moderate tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-C2orf43 Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.

Quick Database Links

Gene Symbol

LDAH

UniProt

Q9H6V9

RefSeq (Protein):NP_068744