LDAH Rabbit Polyclonal Antibody

• Catalog Number: orb585418
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LDAH
• Target: LDAH
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: TIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPHAFIT
• UniProt ID: Q9H6V9
• MW: 36kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: hLDAH, C2orf43
• Note: For research use only
• NCBI: NP_068744

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. C2orf43 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Rabbit Anti-C2orf43 Antibody, Catalog Number: orb585418, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Membrane, Cytoplasm in hepatocytes, moderate signal, moderate tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-C2orf43 Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.