Cart summary

You have no items in your shopping cart.

A630025C20RIK Rabbit Polyclonal Antibody

SKU: orb324711

Description

Rabbit polyclonal antibody to Lcor

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse A630025C20RIK
TargetLcor
Protein SequenceSynthetic peptide located within the following region: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK
Molecular Weight47 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti Mlr2 antibody, anti mKIAA1795 antibody, anti 3110023F06Rik antibody, anti A630025C20Rik antibody

Similar Products

  • A630025C20RIK Rabbit Polyclonal Antibody (Biotin) [orb2130389]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
  • A630025C20RIK Rabbit Polyclonal Antibody (HRP) [orb2130390]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • A630025C20RIK Rabbit Polyclonal Antibody (FITC) [orb2130391]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

A630025C20RIK Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

A630025C20RIK Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody Dilution: 3 ug/mL.

A630025C20RIK Rabbit Polyclonal Antibody

Sample Tissue: Mouse Lung, Antibody Dilution: 1 ug/mL.

A630025C20RIK Rabbit Polyclonal Antibody

Sample Tissue: Mouse Thymus, Antibody Dilution: 3 ug/mL.

A630025C20RIK Rabbit Polyclonal Antibody

WB Suggested Anti-A630025C20RIK Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: SP2/0 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_742166

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

A630025C20RIK Rabbit Polyclonal Antibody (orb324711)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry