A630025C20RIK Rabbit Polyclonal Antibody

• Catalog Number: orb324711
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Lcor
• Target: Lcor
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse A630025C20RIK
• Protein Sequence: Synthetic peptide located within the following region: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK
• UniProt ID: Q6ZPI3
• MW: 47 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti Mlr2 antibody, anti mKIAA1795 antibody, anti
• Note: For research use only
• NCBI: NP_742166

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Mouse Liver, Antibody Dilution: 3 ug/mL.

Sample Tissue: Mouse Lung, Antibody Dilution: 1 ug/mL.

Sample Tissue: Mouse Thymus, Antibody Dilution: 3 ug/mL.

WB Suggested Anti-A630025C20RIK Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: SP2/0 cell lysate.