You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324711 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Lcor |
Target | Lcor |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse A630025C20RIK |
Protein Sequence | Synthetic peptide located within the following region: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK |
UniProt ID | Q6ZPI3 |
MW | 47 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti Mlr2 antibody, anti mKIAA1795 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_742166 |
25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Sample Tissue: Mouse Liver, Antibody Dilution: 3 ug/mL.
Sample Tissue: Mouse Lung, Antibody Dilution: 1 ug/mL.
Sample Tissue: Mouse Thymus, Antibody Dilution: 3 ug/mL.
WB Suggested Anti-A630025C20RIK Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: SP2/0 cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |