Cart summary

You have no items in your shopping cart.

LCN6 Rabbit Polyclonal Antibody (FITC)

LCN6 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2110905

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2110905
CategoryAntibodies
DescriptionLCN6 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LCN6
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW18kDa
UniProt IDP62502
Protein SequenceSynthetic peptide located within the following region: LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR
NCBINP_945184
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesLCN5, hLcn5, UNQ643
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.