You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576846 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LBX1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LBX1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 30 kDa |
Target | LBX1 |
UniProt ID | P52954 |
Protein Sequence | Synthetic peptide located within the following region: DHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG |
NCBI | NP_006553 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HPX6, HPX-6, LBX1H, homeobox Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Filter by Rating