LBX1 Rabbit Polyclonal Antibody

• Catalog Number: orb576846
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LBX1
• Target: LBX1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LBX1
• Protein Sequence: Synthetic peptide located within the following region: DHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG
• UniProt ID: P52954
• MW: 30 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HPX6, HPX-6, LBX1H, homeobox
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_006553
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Higher molecular weight bands are consistent in size with SUMO or Ubiquitin addition.

Rabbit Anti-LBX1 Antibody, Catalog Number: orb576846, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear (rare), Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-LBX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: PANC1 cell lysate. LBX1 is supported by BioGPS gene expression data to be expressed in PANC1.