You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LBX1 |
| Target | LBX1 |
| Protein Sequence | Synthetic peptide located within the following region: DHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG |
| Molecular Weight | 30 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−LBX1 Rabbit Polyclonal Antibody [orb574395]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlLBX1 Antibody (Center) [orb165294]
WB
Other, Rat, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μlSKOR2 Rabbit Polyclonal Antibody [orb1879706]
IF, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Higher molecular weight bands are consistent in size with SUMO or Ubiquitin addition.

Rabbit Anti-LBX1 Antibody, Catalog Number: orb576846, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear (rare), Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-LBX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: PANC1 cell lysate. LBX1 is supported by BioGPS gene expression data to be expressed in PANC1.
Documents Download
Request a Document
Protocol Information
LBX1 Rabbit Polyclonal Antibody (orb576846)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







