You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329782 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LARP1 |
Target | LARP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LARP2 |
Protein Sequence | Synthetic peptide located within the following region: RNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPP |
UniProt ID | Q6PKG0 |
MW | 116kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti LARP antibody, anti LARP2 antibody |
Research Area | Epigenetics & Chromatin, Molecular Biology |
Note | For research use only |
NCBI | NP_056130 |
Expiration Date | 12 months from date of receipt. |
Human Brain
WB Suggested Anti-LARP2 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, LARP1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Rabbit | |
Polyclonal | |
Unconjugated |