LAPTM4A Rabbit Polyclonal Antibody

• Catalog Number: orb579950
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LAPTM4A
• Target: LAPTM4A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LAPTM4A
• Protein Sequence: Synthetic peptide located within the following region: VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA
• UniProt ID: Q15012
• MW: 27 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MBNT, Mtrp, LAPTM4, HUMORF13
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_055528

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

WB Suggested Anti-LAPTM4A Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate. LAPTM4A is supported by BioGPS gene expression data to be expressed in HepG2.