LAMP1 Rabbit Polyclonal Antibody

• Catalog Number: orb584161
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LAMP1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Porcine, Rabbit
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: LAMP1
• UniProt ID: P11279
• Protein Sequence: Synthetic peptide located within the following region: NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY
• NCBI: AAF66141
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LAMPA, CD107a, LGP120
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Mouse NLT cells, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: Green: Lamp1, Gene Name: LAMP1.

WB Suggested Anti-LAMP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that LAMP1 is expressed in HepG2.