You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584161 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LAMP1 |
Target | LAMP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP1 |
Protein Sequence | Synthetic peptide located within the following region: NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY |
UniProt ID | P11279 |
MW | 39kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | LAMPA, CD107a, LGP120 |
Note | For research use only |
NCBI | AAF66141 |
Sample Type: Mouse NLT cells, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: Green: Lamp1, Gene Name: LAMP1.
WB Suggested Anti-LAMP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that LAMP1 is expressed in HepG2.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Mouse, Porcine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |