You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324842 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCBL2 |
Target | KYAT3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-82K18.3 |
Protein Sequence | Synthetic peptide located within the following region: SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA |
UniProt ID | Q6YP21 |
MW | 46kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti RP11-82K18.3 antibody, anti RP4-531M19.2 anti Read more... |
Note | For research use only |
NCBI | NP_001008662 |
WB Suggested Anti-RP11-82K18.3 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate, CCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |