Cart summary

You have no items in your shopping cart.

KRT38 Rabbit Polyclonal Antibody (FITC)

KRT38 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088219

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088219
CategoryAntibodies
DescriptionKRT38 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Human, Rabbit
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human KRT38
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW50kDa
UniProt IDO76015
Protein SequenceSynthetic peptide located within the following region: AYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERSKCH
NCBINP_006762
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHA8, hHa8, KRTHA8
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.