KRT23 Rabbit Polyclonal Antibody

• Catalog Number: orb580068
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KRT23
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Guinea pig
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRT23
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: KRT23
• UniProt ID: Q9C075
• Protein Sequence: Synthetic peptide located within the following region: IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR
• NCBI: NP_056330
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: K23, CK23, HAIK1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry of formalin-fixed, paraffin-embedded human placenta tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

WB Suggested Anti-KRT23 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.