You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
KRT23 Rabbit Polyclonal Antibody
Catalog Number: orb580068
Product Properties
| Catalog Number | orb580068 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KRT23 |
| Target | KRT23 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Guinea pig |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KRT23 |
| Protein Sequence | Synthetic peptide located within the following region: IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR |
| UniProt ID | Q9C075 |
| MW | 48kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | K23, CK23, HAIK1 |
| Note | For research use only |
| NCBI | NP_056330 |
Images
Immunohistochemistry of formalin-fixed, paraffin-embedded human placenta tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
WB Suggested Anti-KRT23 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.
Similar Products
- Item 1 of 2
Reviews
KRT23 Rabbit Polyclonal Antibody (orb580068)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review