KRAS Rabbit Polyclonal Antibody

• Catalog Number: orb582745
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KRAS
• Target: KRAS
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRAS
• Protein Sequence: Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC
• UniProt ID: P01111
• MW: 22 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NS, NS3, OES, CFC2, RALD, K-Ras, KRAS1, KRAS2, RAS
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_203524
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Positive control (+): Human stomach (ST), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.

WB Suggested Anti-KRAS Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.