Cart summary

You have no items in your shopping cart.

KPRP Rabbit Polyclonal Antibody (FITC)

KPRP Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2089086

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2089086
CategoryAntibodies
DescriptionKPRP Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human KPRP
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW64kDa
UniProt IDQ5T749
Protein SequenceSynthetic peptide located within the following region: PHRLDTEAPYCGPSSYNQGQESGAGCGPGDVFPERRGQDGHGDQGNAFAG
NCBINP_001020402
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesC1orf45
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.