KPNA4 Rabbit Polyclonal Antibody

• Catalog Number: orb582432
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KPNA4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KPNA4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: KPNA4
• UniProt ID: O00629
• Protein Sequence: Synthetic peptide located within the following region: KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI
• NCBI: NP_002259
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: QIP1, SRP3, IPOA3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. KPNA4 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. KPNA4 is supported by BioGPS gene expression data to be expressed in MCF7.

KPNA4 antibody - N-terminal region (orb582432) validated by WB using Neuro 2A Cells at 1:500.

WB Suggested Anti-KPNA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate. KPNA4 is supported by BioGPS gene expression data to be expressed in HeLa.