You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582432 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KPNA4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KPNA4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | KPNA4 |
UniProt ID | O00629 |
Protein Sequence | Synthetic peptide located within the following region: KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI |
NCBI | NP_002259 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | QIP1, SRP3, IPOA3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. KPNA4 is supported by BioGPS gene expression data to be expressed in HeLa.
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. KPNA4 is supported by BioGPS gene expression data to be expressed in MCF7.
KPNA4 antibody - N-terminal region (orb582432) validated by WB using Neuro 2A Cells at 1:500.
WB Suggested Anti-KPNA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate. KPNA4 is supported by BioGPS gene expression data to be expressed in HeLa.
ICC, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |