You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585839 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KMO |
Target | KMO |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KMO |
Protein Sequence | Synthetic peptide located within the following region: RLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFD |
UniProt ID | O15229 |
MW | 49kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | dJ317G22.1 |
Note | For research use only |
Sample Type: 293T Whole cell lysates, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that KMO is expressed in HEK293T.
WB | |
Canine, Equine, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |