KLB Rabbit Polyclonal Antibody

• Catalog Number: orb325853
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KLB
• Target: KLB
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLB
• Protein Sequence: Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
• UniProt ID: Q86Z14
• MW: 120 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BKL antibody, anti MGC142213 antibody
• Note: For research use only
• NCBI: NP_783864

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 0.5 ug/mL.

Human Testis

Immunohistochemistry of formalin-fixed, paraffin-embedded human colon tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.

Immunohistochemistry of formalin-fixed, paraffin-embedded human testis tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.

WB Suggested Anti-KLB Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.