KITLG Rabbit Polyclonal Antibody

• Catalog Number: orb579138
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KITLG
• Target: KITLG
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KITLG
• Protein Sequence: Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
• UniProt ID: P21583
• MW: 28kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SF, MGF, SCF, SLF, DCUA, FPH2, FPHH, KL-1, Kitl, S
• Research Area: Cell Biology, Signal Transduction, Stem Cell & Dev
• Note: For research use only
• NCBI: NP_000890
• Expiration Date: 12 months from date of receipt.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): Human lung (LU), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-KITLG Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.