Cart summary

You have no items in your shopping cart.

KIFC2 Rabbit Polyclonal Antibody (FITC)

KIFC2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2135779

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2135779
CategoryAntibodies
DescriptionKIFC2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KIFC2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW90kDa
UniProt IDQ96AC6
Protein SequenceSynthetic peptide located within the following region: TQGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGA
NCBINP_665697
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.
  • KIFC2 Rabbit Polyclonal Antibody (FITC) [orb2135782]

    IHC,  WB

    Bovine, Equine, Human, Mouse

    Rabbit

    Polyclonal

    FITC

    100 μl