KIF5B Rabbit Polyclonal Antibody

SKU: orb574872

Description

Rabbit polyclonal antibody to KIF5B

Research Area

Epigenetics

Images & Validation

−

Item 1 of 6

Tested Applications	IHC-P, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Mouse, Porcine, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5B
Target	KIF5B
Protein Sequence	Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
Molecular Weight	110kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

KNS, KINH, KNS1, UKHC, HEL-S-61

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 2 ug/ml.

Human Liver

KIF5B was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574872 with 1:200 dilution. Western blot was performed using orb574872 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: KIF5B IP with orb574872 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-KIF5B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Quick Database Links

Gene Symbol

KIF5B

UniProt

P33176

RefSeq (Protein):NP_004512

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_004512

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC-P

Immunohistochemistry Paraffin

View Protocol

Find More Protocols