KIF5B Rabbit Polyclonal Antibody

• Catalog Number: orb574872
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIF5B
• Target: KIF5B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5B
• Protein Sequence: Synthetic peptide located within the following region: CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST
• UniProt ID: P33176
• MW: 110kDa
• Tested applications: IHC-P, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: KNS, KINH, KNS1, UKHC, HEL-S-61
• Note: For research use only
• NCBI: NP_004512

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): Hela (HL), Negative control (-): Human liver (LI), Antibody concentration: 2 ug/ml.

Human Liver

KIF5B was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574872 with 1:200 dilution. Western blot was performed using orb574872 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: KIF5B IP with orb574872 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-KIF5B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-KIF5B Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.