KIF20A Rabbit Polyclonal Antibody

SKU: orb592767

Description

Rabbit polyclonal antibody to KIF20A

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIF20A
• Target: KIF20A
• Protein Sequence: Synthetic peptide located within the following region: KRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRR
• Molecular Weight: 100kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MKLP2, RAB6KIFL

Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue.

Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue.

Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue.

Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KIF20A antibody (orb592767).

KIF20A antibody - middle region (orb592767) validated by WB using 721_B Cell Lysate at 1 ug/ml. KIF20A is supported by BioGPS gene expression data to be expressed in 721_B.

Quick Database Links

Gene Symbol

KIF20A

UniProt

O95235

RefSeq (Protein):NP_005724