KIF20A Rabbit Polyclonal Antibody

• Catalog Number: orb592767
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIF20A
• Target: KIF20A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIF20A
• Protein Sequence: Synthetic peptide located within the following region: KRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRR
• UniProt ID: O95235
• MW: 100kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MKLP2, RAB6KIFL
• Note: For research use only
• NCBI: NP_005724

Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue.

Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue.

Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue.

Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KIF20A antibody (orb592767).

KIF20A antibody - middle region (orb592767) validated by WB using 721_B Cell Lysate at 1 ug/ml. KIF20A is supported by BioGPS gene expression data to be expressed in 721_B.