You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585308 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KIF1BP |
Target | KIF1BP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Kbp |
Protein Sequence | Synthetic peptide located within the following region: RVELHKNPEKEPYKSKYGARALLEEVRALLGPAPEDEDEPAADDGPGDQA |
UniProt ID | Q6ZPU9 |
MW | 43kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | KBP, Kif1, Kif1bp, mKIAA1279, 0710007C18Rik, 25100 Read more... |
Note | For research use only |
Sample Type: Mouse Thymus lysates, Antibody dilution: 1.0 ug/ml.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |