KIF13B Rabbit Polyclonal Antibody

SKU: orb574884

Description

Rabbit polyclonal antibody to KIF13B

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF13B
• Target: KIF13B
• Protein Sequence: Synthetic peptide located within the following region: SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE
• Molecular Weight: 203kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GAKIN

Sample Tissue: Human A172 Whole Cell, Antibody dilution: 3 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): HeLa (HL), Antibody concentration: 3 ug/ml.

Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KIF13B antibody (orb574884).

Rabbit Anti-KIF13B Antibody, Paraffin Embedded Tissue: Human Prostate, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-KIF13B Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate, KIF13B is supported by BioGPS gene expression data to be expressed in HepG2.

Quick Database Links

Gene Symbol

KIF13B

UniProt

Q9NQT8

RefSeq (Protein):NP_056069