KIF13B Rabbit Polyclonal Antibody

• Catalog Number: orb574884
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIF13B
• Target: KIF13B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KIF13B
• Protein Sequence: Synthetic peptide located within the following region: SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE
• UniProt ID: Q9NQT8
• MW: 203kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GAKIN
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_056069

Sample Tissue: Human A172 Whole Cell, Antibody dilution: 3 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): HeLa (HL), Antibody concentration: 3 ug/ml.

Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KIF13B antibody (orb574884).

Rabbit Anti-KIF13B Antibody, Paraffin Embedded Tissue: Human Prostate, Antibody Concentration: 5 ug/ml.

WB Suggested Anti-KIF13B Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate, KIF13B is supported by BioGPS gene expression data to be expressed in HepG2.