Cart summary

You have no items in your shopping cart.

KIAA0930 Rabbit Polyclonal Antibody (FITC)

KIAA0930 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2105388

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2105388
CategoryAntibodies
DescriptionKIAA0930 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen for Anti-KIAA0930 antibody is: synthetic peptide directed towards the C-terminal region of Human K0930
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW40 kDa
UniProt IDQ6ICG6
Protein SequenceSynthetic peptide located within the following region: PSLKRKVPRNRIAEMKKSHSANDSEEFFREDDGGADLHNATNLRSRSLSG
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesLSC3, C22orf9
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.