KEAP1 Rabbit Polyclonal Antibody

• Catalog Number: orb575230
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KEAP1
• Target: KEAP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KEAP1
• Protein Sequence: Synthetic peptide located within the following region: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS
• UniProt ID: Q14145
• MW: 70kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: INrf2, KLHL19
• Note: For research use only
• NCBI: NP_987096

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. KEAP1 is supported by BioGPS gene expression data to be expressed in HepG2.

Human kidney

WB Suggested Anti-KEAP1 Antibody Titration: 1.0 ug/ml, Positive Control: HepG2 cell lysate, KEAP1 is supported by BioGPS gene expression data to be expressed in HepG2.