You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324798 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KDM6A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human UTX |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 154kDa |
Target | KDM6A |
UniProt ID | O15550 |
Protein Sequence | Synthetic peptide located within the following region: KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS |
NCBI | NP_066963 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DKFZp686A03225 antibody, anti MGC141941 antib Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Positive control (+): Human Ovary (OV), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/mL.
WB Suggested Anti-UTX Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate, KDM6A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
PE |