JMJD2C Rabbit Polyclonal Antibody

• Catalog Number: orb574462
• Category: Antibodies
• Description: Rabbit polyclonal antibody to JMJD2C
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD2C
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 92 kDa
• Target: KDM4C
• UniProt ID: F5H347
• Protein Sequence: Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR
• NCBI: NP_001140167
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GASC1, JHDM3C, JMJD2C, TDRD14C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 92 kDa isoform is identified, and a second isoform of ~90 kDa is also present in some samples.

Antibody dilution: 1.0 ug/ml, Sample Type: Jurkat cell lysate.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.