You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574462 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to JMJD2C |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human JMJD2C |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 92 kDa |
Target | KDM4C |
UniProt ID | F5H347 |
Protein Sequence | Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR |
NCBI | NP_001140167 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GASC1, JHDM3C, JMJD2C, TDRD14C Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 92 kDa isoform is identified, and a second isoform of ~90 kDa is also present in some samples.
Antibody dilution: 1.0 ug/ml, Sample Type: Jurkat cell lysate.
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |