KCNK9 Rabbit Polyclonal Antibody

• Catalog Number: orb575424
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNK9
• Target: KCNK9
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNK9
• Protein Sequence: Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY
• UniProt ID: Q9NPC2
• MW: 42 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: KT3.2, TASK3, BIBARS, K2p9.1, TASK-3, TASK32
• Note: For research use only
• NCBI: NP_057685
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KCNK9 antibody (orb575424).

Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KCNK9 antibody (orb575424).

WB Suggested Anti-KCNK9 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.