You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329807 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNK3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Rabbit, Rat, Sheep |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 43kDa |
Target | KCNK3 |
UniProt ID | O14649 |
Protein Sequence | Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL |
NCBI | NP_002237 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti TASK antibody, anti TBAK1 antibody, anti K2p3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/mL.
Positive control (+): Hela (HL), Negative control (-): Liver tumor (T-LI), Antibody concentration: 3 ug/mL.
WB Suggested Anti-KCNK3 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Canine, Gallus, Human, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Human, Mouse | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |