KCNK3 Rabbit Polyclonal Antibody

• Catalog Number: orb329807
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNK3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43kDa
• Target: KCNK3
• UniProt ID: O14649
• Protein Sequence: Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
• NCBI: NP_002237
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti TASK antibody, anti TBAK1 antibody, anti K2p3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/mL.

Positive control (+): Hela (HL), Negative control (-): Liver tumor (T-LI), Antibody concentration: 3 ug/mL.

WB Suggested Anti-KCNK3 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.