You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb589648 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNJ2 |
Target | KCNJ2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KCNJ2 |
Protein Sequence | Synthetic peptide located within the following region: SFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRPLR |
UniProt ID | P63252 |
MW | 46 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | IRK1, LQT7, SQT3, ATFB9, HHIRK1, KIR2.1, HHBIRK1 |
Note | For research use only |
NCBI | NP_000882.1 |
Sample Tissue: Human HepG2 Whole Cell lysates, Antibody Dilution: 1 ug/ml.
FC, WB | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |