You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324605 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNJ1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KCNJ1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45 kDa |
Target | KCNJ1 |
UniProt ID | P48048 |
Protein Sequence | Synthetic peptide located within the following region: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP |
NCBI | NP_000211 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti KIR1.1 antibody, anti ROMK antibody, anti ROM Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at 43 kDa and 45 kDa. Protein may be modified by glyco.
Lanes: Lane 1: 30 ug mouse renal epithelial lysate, Lane 2: 30 ug mouse renal epithelial lysate, Lane 3: 30 ug mouse renal epithelial lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:2500, Gene Name: KCNJ1.
WB Suggested Anti-KCNJ1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
ELISA, IF, IHC-P | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |