KCNJ1 Rabbit Polyclonal Antibody

SKU: orb324605

Description

Rabbit polyclonal antibody to KCNJ1

Research Area

Cell Biology, Pharmacology & Drug Discovery

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNJ1
• Target: KCNJ1
• Protein Sequence: Synthetic peptide located within the following region: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP
• Molecular Weight: 45 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti KIR1.1 antibody, anti ROMK antibody, anti ROMK1 antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Isoforms containing the peptide sequence are present at 43 kDa and 45 kDa. Protein may be modified by glyco.

Lanes: Lane 1: 30 ug mouse renal epithelial lysate, Lane 2: 30 ug mouse renal epithelial lysate, Lane 3: 30 ug mouse renal epithelial lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:2500, Gene Name: KCNJ1.

WB Suggested Anti-KCNJ1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

KCNJ1

UniProt

P48048

RefSeq (Protein):NP_000211