KCNC3 Rabbit Polyclonal Antibody

• Catalog Number: orb575388
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNC3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNC3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 80kDa
• Target: KCNC3
• UniProt ID: Q14003
• Protein Sequence: Synthetic peptide located within the following region: YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM
• NCBI: NP_004968
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: KV3.3, SCA13, KSHIIID
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. KCNC3 is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-KCNC3 Antibody, Catalog Number: orb575388, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-KCNC3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, KCNC3 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-KCNC3 antibody Titration: 1 ug/ml, Sample Type: Human liver.