KCNC3 Rabbit Polyclonal Antibody

SKU: orb575388

Description

Rabbit polyclonal antibody to KCNC3

Research Area

Cell Biology, Pharmacology & Drug Discovery

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNC3
• Target: KCNC3
• Protein Sequence: Synthetic peptide located within the following region: YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM
• Molecular Weight: 80kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

KV3.3, SCA13, KSHIIID

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. KCNC3 is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-KCNC3 Antibody, Catalog Number: orb575388, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-KCNC3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, KCNC3 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-KCNC3 antibody Titration: 1 ug/ml, Sample Type: Human liver.

Quick Database Links

Gene Symbol

KCNC3

UniProt

Q14003

RefSeq (Protein):NP_004968