JUN Rabbit Polyclonal Antibody

• Catalog Number: orb592934
• Category: Antibodies
• Description: Rabbit polyclonal antibody to JUN
• Target: JUN
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human JUN
• Protein Sequence: Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP
• UniProt ID: P05412
• MW: 36kDa
• Tested applications: ChIP, IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AP1, p39, AP-1, cJUN, c-Jun
• Note: For research use only
• NCBI: NP_002219

Chromatin Immunoprecipitation (ChIP) Using JUN antibody - N-terminal region (orb592934) and HCT116 Cells.

Rabbit Anti-JUN Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-JUN Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T. JUN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.