Cart summary

You have no items in your shopping cart.

JADE2 Rabbit Polyclonal Antibody (Biotin)

JADE2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2127859

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2127859
CategoryAntibodies
DescriptionJADE2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of human JADE2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW63kDa
UniProt IDQ9NQC1
Protein SequenceSynthetic peptide located within the following region: MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPS
NCBINP_001276913.1
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPHF15, JADE-2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.