ITGB8 Rabbit Polyclonal Antibody

• Catalog Number: orb579418
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ITGB8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ITGB8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 85 kDa
• Target: ITGB8
• UniProt ID: P26012
• Protein Sequence: Synthetic peptide located within the following region: CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL
• NCBI: NP_002205
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 0.5 ug/ml.

Sample Type: Human Kidney, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-ITGB8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

WB Suggested Anti-ITGB8 antibody Titration: 1 ug/ml, Sample Type: Human Raji.