Cart summary

You have no items in your shopping cart.

ISCA2 Rabbit Polyclonal Antibody (FITC)

ISCA2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2107740

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2107740
CategoryAntibodies
DescriptionISCA2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ISCA2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW16kDa
UniProt IDQ86U28
Protein SequenceSynthetic peptide located within the following region: RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY
NCBINP_919255
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesISA2, HBLD1, MMDS4, c14_5557
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.