You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578606 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IRX3 |
Target | IRX3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human IRX3 |
Protein Sequence | Synthetic peptide located within the following region: SPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGPRLHPLSLLGSAPPHL |
UniProt ID | P78415 |
MW | 52kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | IRX-1, IRXB1 |
Research Area | Epigenetics & Chromatin, Stem Cell & Developmental Read more... |
Note | For research use only |
NCBI | NP_077312 |
Expiration Date | 12 months from date of receipt. |
Human Skin
Rabbit Anti-IRX3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-IRX3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Uterus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-IRX3 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
IHC, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Mouse, Other | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |