Cart summary

You have no items in your shopping cart.

IQCF1 Rabbit Polyclonal Antibody (FITC)

IQCF1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2108502

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2108502
CategoryAntibodies
DescriptionIQCF1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human IQCF1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW24kDa
UniProt IDQ8N6M8
Protein SequenceSynthetic peptide located within the following region: ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF
NCBINP_689610
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesFLJ27508, MGC39725
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.