You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb2693010 |
|---|---|
| Category | Proteins |
| Description | Intermedin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. |
| Target | others |
| Purity | ≥95% |
| Protein Sequence | PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2 (Disulfide bridge:Cys10-Cys15) |
| MW | 5216.99 |
| CAS Number | 1816940-00-7 |
| Formula | C226H361N75O64S2 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Rat | |
156.25-10000 pg/mL | |
47.6 pg/mL |
Rat | |
78.13-5000pg/mL | |
46.88 pg/mL |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review