Intermedin (rat)

SKU: orb2693010

Description

Intermedin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.

Images & Validation

−

Key Properties

−

Target	others
CAS Number	1816940-00-7
MW	5216.99
Purity	≥95%
Formula	C₂₂₆H₃₆₁N₇₅O₆₄S₂
Protein Sequence	PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2 (Disulfide bridge:Cys10-Cys15)

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

others

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Reactivity:	Rat
Dynamic Range:	78.13-5000pg/mL
Sensitivity:	46.88 pg/mL

Reactivity:	Rat
Dynamic Range:	156.25-10000 pg/mL
Sensitivity:	47.6 pg/mL

Reactivity:	Rat
Dynamic Range:	78.13-5000pg/mL
Sensitivity:	41.56pg/mL

Reactivity:	Rat
Dynamic Range:	78.13-5000pg/mL
Sensitivity:	46.09pg/mL

Applications:	IF
Predicted Reactivity:	Equine, Porcine, Rabbit
Reactivity:	Human, Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	FITC

Intermedin (rat)

Description

Images & Validation

Key Properties

Storage & Handling

Similar Products

Rat beta-Melanocyte Stimulating Hormone (βMSH) ELISA Kit [orb1947419]

Rat Alpha-Melanocyte Stimulating Hormone (aMSH) ELISA Kit [orb778961]

MF-Rat βMSH(beta-Melanocyte Stimulating Hormone) ELISA Kit [orb3202336]

FS-Rat βMSH(beta-Melanocyte Stimulating Hormone) ELISA Kit [orb3196008]

ADM2 Rabbit Polyclonal Antibody (FITC) [orb102839]

Quality Guarantee

Quick Database Links

Protocol Information

Available Sizes

Email

UK Office

US Office

CN Office

Distributors