ING1 Rabbit Polyclonal Antibody

• Catalog Number: orb581112
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ING1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ING1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: ING1
• UniProt ID: Q5T9H0
• Protein Sequence: Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD
• NCBI: NP_937862
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: p33, p47, p33ING1, p24ING1c, p33ING1b, p47ING1a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1: 30 ug HeLa lysate, 2: 30 ug HFF lysate, 3: 30 ug U2OS lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: ING1.

WB Suggested Anti-ING1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that ING1 is expressed in HepG2.