You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330749 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IMPDH2 |
Target | IMPDH2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IMPDH2 |
Protein Sequence | Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD |
UniProt ID | P12268 |
MW | 56 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti IMPD2 antibody, anti IMPDH-II antibody |
Research Area | Cell Biology, Epigenetics & Chromatin |
Note | For research use only |
NCBI | NP_000875 |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.
Sample Type: Human Hep-2 cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 568, Secondary Antibody dilution: 1:400, Color/Signal Descriptions: Red: IMPDH2 Blue: DAPI, Gene Name: IMPDH2.
WB Suggested Anti-IMPDH2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate, IMPDH2 is supported by BioGPS gene expression data to be expressed in 721_B.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Hamster, Mouse, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |